SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B7YE76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B7YE76
Domain Number 1 Region: 25-79
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000288
Family Transducin (heterotrimeric G protein), gamma chain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2B7YE76
Sequence length 90
Comment (tr|A0A2B7YE76|A0A2B7YE76_9EURO) Uncharacterized protein {ECO:0000313|EMBL:PGH19208.1} KW=Complete proteome; Reference proteome OX=1447883 OS=Polytolypa hystricis UAMH7299. GN=AJ80_04179 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Polytolypa.
Sequence
MPAYELRPGGDVRNKKHSMAELKLRRLNELNLRLKEDLDRPRVKVAEASMSLINYCNNTR
DFMVPSVWGQVDKREDPYAPQQQGGCCTIM
Download sequence
Identical sequences A0A2B7YE76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]