SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C0KI79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2C0KI79
Domain Number - Region: 468-497
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0233
Family FIS-like 0.036
Further Details:      
 
Domain Number - Region: 384-439
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0915
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2C0KI79
Sequence length 527
Comment (tr|A0A2C0KI79|A0A2C0KI79_BACME) PucR family transcriptional regulator {ECO:0000313|EMBL:PGQ79525.1} KW=Complete proteome OX=1404 OS=Bacillus megaterium. GN=COA18_27100 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MELQTLLRIPIYEKASVVAGQKGVTRKVHNVNMMDAPDILSFLKEGEFLITTGYHFKEHE
ESLAKLVEGMAKKKCAGLAIKTKRFFEHVPASICQLADELHFPIIDFQTDETLGAVINES
LSFILDKKTAELQQAMVTHQLFSSYILQGKGIEKIMQSIQTLCNAHVALFDTHGHELFYT
NKREPFSLPMEEAVAGAKQLFLRTSKYTTFSFLHTKKTVTLFPIATHTRKYSYLLIEHQV
SLSDSALLTIEQATNVLSFEMMRQQALYEAERRRKNDFFNQLVNNYYKTLEDASFQAQMM
GLSAGNSYICAVGKIHSTFTPYSDDDMIYELLQYELSTGHTEAVLFFYDNLYILLFTPHS
QPMIIECLHRLQEAVYRHYDKRMSFGVGNQSQSLLTIADSYKEAVEALETIHFKDQSKLI
QFYQPKQFKELLRLLPANDLQDYYSQTLEGLLQYDKKDRSILLDTLETYLNSNCQISETA
KQLFVHRNTVIYRIEKCEELLKRPIHTSEETLRLRVAFQIFSLVHAN
Download sequence
Identical sequences A0A0Q6I2P3 A0A0Q9UWX5 A0A2C0KI79 D5DW66
WP_013057705.1.53165 WP_013057705.1.64554 WP_013057705.1.82953 gi|294499764|ref|YP_003563464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]