SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C0S0Z7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2C0S0Z7
Domain Number - Region: 26-133
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0173
Family Capz beta-1 subunit 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C0S0Z7
Sequence length 146
Comment (tr|A0A2C0S0Z7|A0A2C0S0Z7_BACCE) Uncharacterized protein {ECO:0000313|EMBL:PDZ95990.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=COK18_07580 OC=Bacillus cereus group.
Sequence
MNTINKILSDFADINTDEYVRNYYELSIMSENKEDNIFVLAKKATYATSNDTLELIRLKE
WKKEFLICQYSNGESSWFGKIPCGYDLHGLTPKEFIIEQLLNVFKQEPDEVYWIKLDPGG
YYACCYEEYLFKTNTGIYFFSMQVHD
Download sequence
Identical sequences A0A243EV78 A0A2C0S0Z7 C2WGQ8
WP_001092362.1.1354 WP_001092362.1.24795 WP_001092362.1.54240 WP_001092362.1.60334 WP_001092362.1.95576 WP_001092362.1.97561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]