SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C1DNB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2C1DNB3
Domain Number - Region: 32-118
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0837
Family Capz beta-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C1DNB3
Sequence length 146
Comment (tr|A0A2C1DNB3|A0A2C1DNB3_BACCE) Uncharacterized protein {ECO:0000313|EMBL:PGT01862.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=COD09_14135 OC=Bacillus cereus group.
Sequence
MEKINRILSDFAKVNEYDGVGNDYRLYLLSENTKEDICELIKKDIKATSDDTIELIQLNE
WQQDFLSCEFPDSEEYWFGTIPSGYDLKGLTPKEFIIEQLLNTFEQGIGAVYWVKLDIGA
YYACSYEEYVFVTNKGIYYLSMQVHD
Download sequence
Identical sequences A0A1E8AXX1 A0A2C1DNB3 J8N3U5 J8NZ78
WP_002192034.1.22507 WP_002192034.1.37649 WP_002192034.1.46157 WP_002192034.1.47674 WP_002192034.1.86789 WP_002192034.1.99044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]