SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C5XGT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C5XGT1
Domain Number 1 Region: 378-611
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.14e-68
Family Capz alpha-1 subunit 0.00002
Further Details:      
 
Domain Number 2 Region: 64-267
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-63
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000558
Further Details:      
 
Domain Number 3 Region: 252-382
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.59e-34
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000884
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C5XGT1
Sequence length 620
Comment (tr|A0A2C5XGT1|A0A2C5XGT1_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:PHH71869.1} KW=Complete proteome; Reference proteome OX=2004952 OS=Ophiocordyceps camponoti-rufipedis. GN=CDD80_4931 OC=Ophiocordyceps.
Sequence
MKRQAVRLFGSVVPRRLYSTHPANARLNVPIDYSTTPLLASHGGRAALGDATEMPADVRS
GPAKKMNLFQAVNDALGIALAQDDNVVVLGEDVAFGGVFRCTMRLAETYGSDRVFNTPLT
EQGIVGFGIGLAAQGMRPVAEIQFADYIYPAFDQMINEASKMRYREGANQRHAGGLTVRV
PCGAVGHGGLYHSQSPESLFTHVPGFRVIVPRSPVQAKGLLLAAIRCNDPCLFLEPKILY
RAAVEQVPEAAYELPLSKAERLKEGKDITVISYGQPLYLCLSAIQRAEEDLGISAELIDL
RTIYPWDKQAVFESVRKTGRAVIVHESMINAGVGAEVAAAIQEDGDTFVRLEAPVARVGG
WSVHNPLIFEKFTIPDVANIKALTVSSPDIVSEIEPALKKYNEEQLVTVKLPGSSQSVLI
SPYNSLGDGRYYDVESSSSFSFDHKTQASWRREAGADLAKSTMKSLGSYVKEHFASAAYG
AFPIESDSKLAVVIVASKYSPNNFWNGRWRSVYTFDPASGSLEGSIKVDVHYYEDGNVRL
LTEKPVSASVGSGTGAGIAKEVSGLEKKYQEEVNRSFVKLSEGAFKGLRRQLPVTRQKIE
WDKVASYRLGQDIGGGSSKR
Download sequence
Identical sequences A0A2C5XGT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]