SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9DYS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2C9DYS2
Domain Number - Region: 476-543
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz beta-1 subunit 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2C9DYS2
Sequence length 721
Comment (tr|A0A2C9DYS2|A0A2C9DYS2_UREP2) Uncharacterized protein {ECO:0000313|EMBL:ACA33078.1} KW=Complete proteome OX=505682 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736). GN=UPA3_0051 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Ureaplasma.
Sequence
MRNKLKIKLKFLASLATIPIVASPLIFSVAANEDGKQENNNGNNHDPNQQKKPKIPKNDP
NFNTFKTDADKTVKDSLEKGINAAIVYVKSRQEEILENKEIEFKKKIQQLIYLKNLQSYL
EKNKENILKNPNDYGFYLNTPQILGTLKNYDIKDIEFNGETYKQIKVGKTDPLNYQKAVA
PKGKISDVQSDQINDVEETKYKDTLKKYESEFLKEINKLIYDENDVPQINKDVELTRDEK
GQFNTTLPKGYNDWNAYFISKIKDRVTAFDLKQNQQTNEDKQEEQPNEQKDPDTPPPLPP
PLVEGDHNEIDLPPTQANAIISSLPLLLPYISPIYSNESLSGLKSKFDSLKPELKQTLFY
FNNPINTRYLYSVLDFGVNGSSMINIKVKIIDQVNPKLQRTYIINKYDPILDINFNSLKL
NEVNAIKQIFVNLYKHLGLDEKIDYKKLRNFYIRNALFTMIEAAQKLILRFNQIDKDNKI
IGQKTFATLQNEYLEKYKQKLVNNTDDKERLLNEFNNLTKENFFRYLNNTLINNDYYWYQ
LVGAYKQVSLQFSEVLRLNKDKIKANIASIKGDENTIANLYKLNNQLIYQLSAIVAQRSF
NSQQWYQSYLNVLQPIKENFDLMSILTNQTDIKTNKDKAKDFKNAYDSALKSLERQKQVN
KQIRRKIGIAFIVISLLVLIINLIIYGLIKKLKNKKVILIINSVIMVLTIIVLIMGIILI
I
Download sequence
Identical sequences A0A2C9DYS2 Q9PR93
WP_010891668.1.15075 WP_010891668.1.72504 WP_010891668.1.74768 273119.UU052 505682.UPA3_0051 gi|13357608|ref|NP_077882.1| gi|170762239|ref|YP_001752131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]