SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C9JBR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9JBR2
Domain Number 1 Region: 32-196
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 2.13e-28
Family Bcl-2 inhibitors of programmed cell death 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2C9JBR2
Sequence length 224
Comment (tr|A0A2C9JBR2|A0A2C9JBR2_BIOGL) Uncharacterized protein {ECO:0000313|VectorBase:BGLB000143-PB, ECO:0000313|VectorBase:BGLB000143-PC, ECO:0000313|VectorBase:BGLB000143-PD} KW=Complete proteome; Reference proteome OX=6526 OS=Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail). GN= OC=Planorbidae; Biomphalaria.
Sequence
MAWSQGQDNHSFLPGGLMTLREPQIRPDSEGNVSAQTEAVFRNYMYQSYENDLNREDAQD
IPVVNELLHLSDPPSPEADIGRQLARFGDSINAKYADVFDSMISNLNLDSDNSENAYEDF
AQIARRVLTTKINWGTILILLNFGYRIALTVLRSKTSQFLSFLSRIVSYICRFILSERIA
KWIADHGGWRAALSYIPLMSSKPFWLVTALQAAAVIGIIFSHRL
Download sequence
Identical sequences A0A2C9JBR2
XP_013070172.1.17457 XP_013070173.1.17457 XP_013070175.1.17457 XP_013070176.1.17457 XP_013070177.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]