SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9K091 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9K091
Domain Number 1 Region: 1-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.24e-91
Family Capz beta-1 subunit 0.00000000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9K091
Sequence length 261
Comment (tr|A0A2C9K091|A0A2C9K091_BIOGL) Uncharacterized protein {ECO:0000313|VectorBase:BGLB010919-PC} KW=Complete proteome; Reference proteome OX=6526 OS=Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail). GN= OC=Planorbidae; Biomphalaria.
Sequence
MRRLPPQQIEKNLCDLIDLVPPLCEDLLSSVDQPLKIVRDKTVGKDYLLCDYNRDGDSYR
SPWSNSYDPPLDDGTMPSESLRRLEIEANSAFDQYREMYFEGGVSSVYLWDLNHGFAGVI
LIKKAGDGSKKIKGCWDSIHVIEVQEKSSGKNAHYKLTSTVMLWLQTSKESSGTMNLGGS
LTRQVESDAPVNENSPHIVNIGKMVEEMENKIRSTLNNIYFGKTKDIVNSLRSIEPLQDP
KQQAAFKKDLFQALSQRTQAQ
Download sequence
Identical sequences A0A2C9K091
XP_013091223.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]