SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9U303 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9U303
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.16e-60
Family Capz beta-1 subunit 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9U303
Sequence length 216
Comment (tr|A0A2C9U303|A0A2C9U303_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY23661.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_18G096400 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MSKVLCDVDCGKGFILCEYNRDADSYRSPWSNKYHPPLEEALFPSSELRKLEIEANEAFT
IYREQYYEGGISSVYLWEDDEREGFVACFLIKKDGSKTGHGRRGYLQEGAWDAIHVIEVG
PEEEKAVHYCLTSTVMLSLTTNDESSGTFSLSGSIRRQMNMDLAIADGHLCNMGRIIEEM
EGRLRNTLDQVYFGKTKEMVCTLRPPPEIVMRLPNS
Download sequence
Identical sequences A0A2C9U303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]