SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D0Q8U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D0Q8U4
Domain Number 1 Region: 19-149
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 3.26e-19
Family Bcl-2 inhibitors of programmed cell death 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D0Q8U4
Sequence length 197
Comment (tr|A0A2D0Q8U4|A0A2D0Q8U4_ICTPU) apoptosis regulator BAX-like isoform X2 {ECO:0000313|RefSeq:XP_017314714.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=LOC108259599 OC=Ictaluridae; Ictalurus.
Sequence
MDGQIGEALIIRVIQDQMMNVNIGGNLSLPCLPEVQPLASVQDQKLLDQLAQSVKVIGDK
LNQEHSLNDQIDGLARLGDRKIFSKLVDGVFYDGQINWGRIIVLFYAVGKLAVKMVLANL
PTVFSEILESCLDFFRTKLLIWIRNMDGWISSISALTQFSIEHISASSFYTIPSPVVAFF
CGILLGSIIVWKFRISS
Download sequence
Identical sequences A0A2D0Q8U4
XP_017314714.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]