SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D2ALI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D2ALI2
Domain Number 1 Region: 80-137
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00000000000458
Family E6 C-terminal domain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.0000000000235
Family E6 C-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D2ALI2
Sequence length 141
Comment (tr|A0A2D2ALI2|A0A2D2ALI2_9PAPI) Protein E6 {ECO:0000256|HAMAP-Rule:MF_04006, ECO:0000256|RuleBase:RU363123, ECO:0000256|SAAS:SAAS01013181} OX=1175851 OS=Gammapapillomavirus 9. GN=E6 OC=Gammapapillomavirus.
Sequence
METLRPTDLKSYCTIFGIDFFELHLQCIFCNCYLSLVDLADFYTKCLCLVWRVGKAHACC
AKCLCLSAKCELERHVQCSAKVVNLHSLTNKPLCELKVRCCQCLALLDLQEKCDLVARGK
DAYLVRGNWRAPCRKCIDREI
Download sequence
Identical sequences A0A2D2ALI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]