SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D2ALX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D2ALX2
Domain Number 1 Region: 85-137
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00000000000654
Family E6 C-terminal domain-like 0.0044
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00000000126
Family E6 C-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D2ALX2
Sequence length 140
Comment (tr|A0A2D2ALX2|A0A2D2ALX2_9PAPI) Protein E6 {ECO:0000256|HAMAP-Rule:MF_04006, ECO:0000256|RuleBase:RU363123, ECO:0000256|SAAS:SAAS01013181} OX=1513263 OS=Gammapapillomavirus 18. GN=E6 OC=Gammapapillomavirus.
Sequence
MAELQPTNLEDYCKFHNCSFFALSFPCVFCKHKVDYLGLAEFHHKTLNLLYKDNVPYVCC
SPCLKLTAKYELQQYYRCSVDAACIEFLCKQPLKDIIVRCLLCYRLLDYLEKYDCVVSDF
PFVLVRHHWRNYCRFCVKQI
Download sequence
Identical sequences A0A2D2ALX2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]