SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4C4W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4C4W2
Domain Number 1 Region: 136-229
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 9.55e-31
Family VPS28 C-terminal domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 28-125
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.27e-28
Family VPS28 N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D4C4W2
Sequence length 231
Comment (tr|A0A2D4C4W2|A0A2D4C4W2_PYTIN) Vacuolar protein sorting-associated protein 28 homolog {ECO:0000256|PIRNR:PIRNR017535} KW=Complete proteome OX=114742 OS=Pythium insidiosum (Pythiosis disease agent). GN=PINS_009297 OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MATPPPPPPPLYAYGHAPVSPAPTSAPEVKLWGNTKERRKFEDLSDLFAIIKTTEHLETA
YVRDAITPEEYTETCTKLISQFKTAETALRLGGFLDDIEAFISQYRLDCPRALERLVRIG
VPATVVHNSTNRKADSVNVAQTVQNFITLMDVLKLNIRAVDEIQPLLCEMMTSLTQVSGL
PADFQGRDKMEGWLRTLNSLRASDELDDDQARQLSFDLERAYSSFMAFLNK
Download sequence
Identical sequences A0A2D4C4W2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]