SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2D4G6A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4G6A7
Domain Number 1 Region: 22-212
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-76
Family Capz beta-1 subunit 0.00000000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D4G6A7
Sequence length 213
Comment (tr|A0A2D4G6A7|A0A2D4G6A7_MICCO) Uncharacterized protein {ECO:0000313|EMBL:LAA55290.1} OX=54390 OS=Micrurus corallinus (Brazilian coral snake). GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
GAETATAATPGPSVRPLRGIMSEQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLL
SSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEA
NNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKS
SGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSL
Download sequence
Identical sequences A0A2D4G6A7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]