SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4JF80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4JF80
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 6.1e-34
Family Bcl-2 inhibitors of programmed cell death 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2D4JF80
Sequence length 111
Comment (tr|A0A2D4JF80|A0A2D4JF80_MICLE) Uncharacterized protein {ECO:0000313|EMBL:LAA95152.1} OX=129467 OS=Micrurus lemniscatus lemniscatus. GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
DAEAQACNSNTKSLSECLRRIGDELDGNTELQRMIEQVQMYPPKEVFFRVAAEMFSDGAF
NWGRVVALFYFACKLVLKVVCSKLPELLKTVISWTMEYIQEHVLSWIQAQG
Download sequence
Identical sequences A0A2D4JF80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]