SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D5VTK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D5VTK9
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 7.85e-31
Family Frataxin-like 0.0000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D5VTK9
Sequence length 110
Comment (tr|A0A2D5VTK9|A0A2D5VTK9_PSESP) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} OX=306 OS=Pseudomonas sp. GN=CMK92_14105 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSLSEARFHDLVDATQQAVEDIFDDSGLDVDLENSAGVLTVRFDNGSQLIFSRQEPIRQL
WLAARSGGFHFDYDEADGRWICDTSDEQLGEMLVRITLEQSGAELEFDEL
Download sequence
Identical sequences A0A0F3G1M7 A0A0Q4TAW9 A0A1G5VN39 A0A1G7CIE0 A0A1H0XH89 A0A1H2MXC0 A0A1I5NXV6 A0A1U9Y340 A0A2D5VTK9 U1T2H1
WP_017678304.1.11777 WP_017678304.1.20494 WP_017678304.1.33620 WP_017678304.1.53550 WP_017678304.1.57322 WP_017678304.1.60508 WP_017678304.1.75364 WP_017678304.1.79076 WP_017678304.1.91885 WP_017678304.1.93622 WP_017678304.1.97512 WP_017678304.1.98092 MES00001033304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]