SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D6VR76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D6VR76
Domain Number 1 Region: 4-198
Classification Level Classification E-value
Superfamily YcfC-like 2.62e-64
Family YcfC-like 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D6VR76
Sequence length 200
Comment (tr|A0A2D6VR76|A0A2D6VR76_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695, ECO:0000256|SAAS:SAAS00958394} OX=2026783 OS=Pseudoalteromonadaceae bacterium. GN=CMK61_09615 OC=Pseudoalteromonadaceae.
Sequence
MTEHQVMALAAMCQVVKQVQKVAQYGQGSDHELEKLLNCIVETSPNSPEDVYQGKHNLRE
GYRILIAQLSAGADKDVEIVKYVGGLMQLERALSSKQNSLNELGRRIDDVKRRLDHFAIT
DDTVVAALADIYSSVLSPLGHRIQVYGKPELLKQQLTQNKIRALLLAGIRSAVLWRQMGG
KRRHFFFAKRKILAIAKQSI
Download sequence
Identical sequences A0A2D6VR76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]