SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E1N899 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E1N899
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.76e-21
Family Frataxin-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2E1N899
Sequence length 113
Comment (tr|A0A2E1N899|A0A2E1N899_9GAMM) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142} OX=2026743 OS=Halieaceae bacterium. GN=CME54_01230 OC=Halieaceae.
Sequence
MAGSVYYEQIEDTFEKVETAIEALPDDVDIRGAEGVINVTFGNGVVFVFSRQPPTEXLWL
ATPGGGFHYLWSXAEXDWXDTKTGARFXXFLXXELLTHTGLRLEWGXGEXTXD
Download sequence
Identical sequences A0A1Z9E5X5 A0A2E1N899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]