SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E1NDV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E1NDV6
Domain Number 1 Region: 1-265
Classification Level Classification E-value
Superfamily Dipeptide transport protein 1.83e-74
Family Dipeptide transport protein 0.000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2E1NDV6
Sequence length 266
Comment (tr|A0A2E1NDV6|A0A2E1NDV6_9BACT) Amino acid amidase {ECO:0000313|EMBL:MAV70152.1} OX=2026760 OS=Candidatus Marinimicrobia bacterium. GN=CMG04_05200 OC=Bacteria; Candidatus Marinimicrobia.
Sequence
MKVYISADMEGITGVTHWDEVDQHKPSYLKFQKQMSLEVAAACKGAKKGGATEIWVKDAH
DSGRNILPEYLPGGVKLIRGWSGHPYSMVQELDYSFDVLVLIGYHSRAGQGGNPLAHTMS
SSKVESIYLNDMQTSEFLLHAYVAGKHKVPIAFLSGDVGLCEEVLKIIPNISTHATMIGI
GNSTISIHPQESVEQIESKVAICLKKDFSNNLLEVPKSFEIKIKFNKAQSAYSASHYLDA
KQLDPKTVXFVAXXYDDIMRFIHFVI
Download sequence
Identical sequences A0A2E1NDV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]