SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E2VDK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E2VDK4
Domain Number 1 Region: 8-87
Classification Level Classification E-value
Superfamily AF1782-like 4.97e-21
Family AF1782-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2E2VDK4
Sequence length 98
Comment (tr|A0A2E2VDK4|A0A2E2VDK4_9EURY) Uncharacterized protein {ECO:0000313|EMBL:MAZ62109.1} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CMB18_02270 OC=Archaea; Euryarchaeota.
Sequence
MSNKGSTVTKEKVEKYLELTAEARGKATQIAESEEDLARLDSMMRMCDDYQADAKHFLEQ
GDLVRAFGAINYAHAWIDAAVRIGLMDGHDDDRLFTLP
Download sequence
Identical sequences A0A2E2VDK4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]