SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E3DRS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E3DRS4
Domain Number 1 Region: 1-266
Classification Level Classification E-value
Superfamily Dipeptide transport protein 1.96e-73
Family Dipeptide transport protein 0.0000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2E3DRS4
Sequence length 267
Comment (tr|A0A2E3DRS4|A0A2E3DRS4_9BACT) Amino acid amidase {ECO:0000313|EMBL:MBA64625.1} OX=2026760 OS=Candidatus Marinimicrobia bacterium. GN=CMG55_02370 OC=Bacteria; Candidatus Marinimicrobia.
Sequence
MKVYISADMEGITGVNHWDEVEHKKPTFYHQFQDRMTKEVLAACEGALDAGVKEIWVKDA
HYSGRNILSEQLPKEVKLIRGWSGHPYSMVQELDSTFNALLMIGYHSMAGRGGNPLAHTM
SSSKIDSIYINDQQTSEFFLHGNIAGKHKVPLVFVSGDAGLCEEVKDVSPNTICHATMVG
VGDSTISIQPLESRNTIRNKVKESLSGDLSYCIWDHPKTYTLKIRFIKQQTAYRASHYLG
AELIDSKTVSFSAKDYDDIMRFILFTV
Download sequence
Identical sequences A0A2E3DRS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]