SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E6V2M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2E6V2M7
Domain Number - Region: 52-89
Classification Level Classification E-value
Superfamily Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 0.0183
Family Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2E6V2M7
Sequence length 114
Comment (tr|A0A2E6V2M7|A0A2E6V2M7_9ALTE) Pilin assembly protein {ECO:0000313|EMBL:MBL82820.1} OX=50741 OS=Marinobacter sp. GN=CMG90_02930 OC=Alteromonadaceae; Marinobacter.
Sequence
MKIKDLVNYWDKHARGRLTRDAYFADLSDQHHKRLEKLAALYPMKSSQDLMRDLISAALD
ELETSFPYVQGSKVVAFDEDGFEIYEDQGMTPRFISLSQKHIQRLKARQLESVA
Download sequence
Identical sequences A0A1I4ITW2 A0A1Q8G6C4 A0A2E6V2M7 A6EVK4 W5YT14
WP_007152055.1.29617 WP_007152055.1.3168 WP_007152055.1.46439 WP_007152055.1.74684 WP_007152055.1.75319 WP_007152055.1.89398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]