SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E8ZZY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E8ZZY6
Domain Number 1 Region: 4-204
Classification Level Classification E-value
Superfamily YcfC-like 1.7e-37
Family YcfC-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2E8ZZY6
Sequence length 208
Comment (tr|A0A2E8ZZY6|A0A2E8ZZY6_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|SAAS:SAAS00958394} OX=1913989 OS=Gammaproteobacteria bacterium. GN=CMD64_04605 OC=Bacteria; Proteobacteria; Gammaproteobacteria.
Sequence
MFLKNIKEQIYALAGLHQACLVVSNLAWRGDYENKXFDALINCXIDTKSTTXEDIFIXQN
YIXKGLRHXKKQIXDDIFTRSXXTRRYISSLEALVNKVDKSEEMISDIGKSIDKLDXSFN
TLSYDEKTKIISDIYQTTLSKIEPRIVVSGKNEYLTKHDISSRIRTALFAGVRCIYLYQQ
YGGNKIKFFLFKKNYTDMLKKIIKTKLN
Download sequence
Identical sequences A0A2E8ZZY6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]