SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2F0BE57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2F0BE57
Domain Number 1 Region: 114-273
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.91e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000289
Further Details:      
 
Domain Number 2 Region: 14-111
Classification Level Classification E-value
Superfamily LCCL domain 9.94e-24
Family LCCL domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2F0BE57
Sequence length 304
Comment (tr|A0A2F0BE57|A0A2F0BE57_ESCRO) Discoidin, CUB and LCCL domain-containing protein 2 {ECO:0000313|EMBL:MBW01257.1} OX=9764 OS=Eschrichtius robustus (California gray whale) (Eschrichtius gibbosus). GN=ESR_06654 OC=Mysticeti; Eschrichtiidae; Eschrichtius.
Sequence
MLPLLVLLVDQILNLITCLDTASSFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLC
MAGVHAGVVSNILGGRISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLG
MESGVIADAQITASSVLEWTDHTGQENSWKPEKARLKKPGPPWAAFATDEYQWLQIDLNK
EKKITGIVTTGSTMVEHNYYVSAYRVLYSDDGQRWTVYREPGVEQDKIFQGNKDYHQDVR
NNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGKATVCLKHVVFTGLIKNDCAVL
REIN
Download sequence
Identical sequences A0A2F0BE57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]