SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G2VEK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G2VEK0
Domain Number 1 Region: 67-141
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.93e-22
Family Skp1 dimerisation domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000023
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G2VEK0
Sequence length 155
Comment (tr|A0A2G2VEK0|A0A2G2VEK0_CAPBA) Uncharacterized protein {ECO:0000313|EMBL:PHT31368.1} KW=Complete proteome; Reference proteome OX=33114 OS=Capsicum baccatum (Peruvian pepper). GN=CQW23_27705 OC=Capsiceae; Capsicum.
Sequence
MLILKSCEEKKFEIEESIAVQSGTIKNMVEDDFTLIPLPNVDTETLIKIIEYMKKHGEET
KSNEKDIEEFDKEFVKKSFTELKELVLAANYLHITSLIDLLCQAFADRIKNESVKAIRQI
FGIPNDFTPEEEAKAYEEHKWAHEGGKEQIDHSAD
Download sequence
Identical sequences A0A2G2VEK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]