SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G2XK15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G2XK15
Domain Number 1 Region: 101-164
Classification Level Classification E-value
Superfamily ssDNA-binding transcriptional regulator domain 6.12e-20
Family Transcriptional coactivator PC4 C-terminal domain 0.00062
Further Details:      
 
Domain Number 2 Region: 5-60
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000471
Family DEK C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G2XK15
Sequence length 168
Comment (tr|A0A2G2XK15|A0A2G2XK15_CAPBA) RNA polymerase II transcriptional coactivator KELP {ECO:0000313|EMBL:PHT57842.1} KW=Complete proteome; Reference proteome OX=33114 OS=Capsicum baccatum (Peruvian pepper). GN=CQW23_00205 OC=Capsiceae; Capsicum.
Sequence
MDSETSNKIEETVLELLKSSNLDEVSELKIRKMASEKLGLDLSDSTRKKLVRQVVEKFLA
EEQAKSEANAEEEEEEEEEEEGGKKRRVGDKEYDDDGDLIVCRLSHKRRVTITDFRGKTL
VSIREYYNKDGKELPTAKGISLTAEQWATFKKNIPGIEKAIKKLESSS
Download sequence
Identical sequences A0A2G2XK15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]