SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G2ZE49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G2ZE49
Domain Number 1 Region: 33-111
Classification Level Classification E-value
Superfamily TSP9-like 5.23e-21
Family TSP9-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G2ZE49
Sequence length 112
Comment (tr|A0A2G2ZE49|A0A2G2ZE49_CAPAN) uncharacterized protein LOC107873810 {ECO:0000313|RefSeq:XP_016576233.1} KW=Complete proteome OX=4072 OS=Capsicum annuum (Bell pepper). GN=LOC107873810 OC=Capsiceae; Capsicum.
Sequence
MASLNLFFTPIATITTQQQQQLQRRSVYTFATAAKSSGESSEEKSLLDFILGGLQKQDQL
LETDPILKKVEDKSVSTTTTNGRKNSVAAVAPKKDSNGSGFGGFGGLFAKKE
Download sequence
Identical sequences A0A1U8H584 A0A2G2ZE49
XP_016576233.1.72714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]