SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G3D7R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G3D7R2
Domain Number 1 Region: 89-252
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 2.88e-17
Family Transcriptional factor tubby, C-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G3D7R2
Sequence length 298
Comment (tr|A0A2G3D7R2|A0A2G3D7R2_CAPCH) Tubby-like F-box protein 2 {ECO:0000313|EMBL:PHU27032.1} KW=Complete proteome; Reference proteome OX=80379 OS=Capsicum chinense (Scotch bonnet) (Bonnet pepper). GN=BC332_05364 OC=Capsiceae; Capsicum.
Sequence
MKGGEGTERKHGSNKTQSQIVPELALSDPIEQGQWANLPPKVLRDIIRRVEESEVSWPDR
AVVVSCASVCNSWRKTTKDVVKTPQECGPISLKQPGPRESPIRCFIKRDKASSVYRLYLG
LIPSEDPRDKLLLAAKRIRRVTGTDFVISLVADDFSEASLNFLGNKFSIYESQPPSDEAI
QHGRLSQRFQENALRHALYPFVFNPAPNEKSFSAPLSKAEESDMDISSSGFSKSAVKVTS
QESLMLKNKTPWCYWQQLILPTIYQSGNKRKSFYSLAELEETPSSWITATLCLPSKLL
Download sequence
Identical sequences A0A2G3D7R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]