SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5BCD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5BCD5
Domain Number 1 Region: 116-170
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 6.8e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00027
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000018
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5BCD5
Sequence length 170
Comment (tr|A0A2G5BCD5|A0A2G5BCD5_COERN) Transcription factor IIA, alpha/beta subunit {ECO:0000313|EMBL:PIA16684.1} OX=763665 OS=Coemansia reversa (strain ATCC 12441 / NRRL 1564). GN=COEREDRAFT_42356 OC=Kickxellaceae; Coemansia.
Sequence
MSNTIVAAIYRYVIDDVVGNVQADFEGHGVDTSVLEELQRSWEAKIIQSRVADSNALARW
QALRDARRAAALPQVDGAEDGNEEDRNHPGNGLDVAPKIELPEDAINSDLDDSDDEYDDE
EGEETEHIILCQYDKVTRSKNKWKCVLRDGIMLINGRDFLFQKANGDFEW
Download sequence
Identical sequences A0A2G5BCD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]