SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5CRH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CRH8
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.000000000000209
Family Preprotein translocase SecE subunit 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CRH8
Sequence length 69
Comment (tr|A0A2G5CRH8|A0A2G5CRH8_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA33790.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_04000091v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDALDSVVDPLRDFAKDSVRLVKRCHKPDRKEFSKVAIRTAIGFVVMGFVGFFVKLIFIP
INNIIVGSG
Download sequence
Identical sequences A0A2G5CRH8
Aquca_040_00091.1|PACid:22044400 Aquca_040_00091.2|PACid:22044401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]