SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5DAX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DAX4
Domain Number 1 Region: 81-220
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.27e-57
Family P-domain of calnexin/calreticulin 0.000000367
Further Details:      
 
Domain Number 2 Region: 1-79,107-116
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-16
Family Calnexin/calreticulin 0.00072
Further Details:      
 
Weak hits

Sequence:  A0A2G5DAX4
Domain Number - Region: 222-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0237
Family Calnexin/calreticulin 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DAX4
Sequence length 349
Comment (tr|A0A2G5DAX4|A0A2G5DAX4_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA40654.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02400012v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MFGPDKCGSTNKVHFIIKHKNPKTGEYVEHHLKFPPSVPSDKLSHVYTAILKPSNEVVIL
VDGEEKKKGNILSADDFEPSLIPDKTIADPDDKKPEDWDEREKIPDPNAVKPEDWDEDAP
MEIEDEEAEKPEGWLDDEPEEIDDPDASKPEDWDDDEDGEWEAPKIDNPKCEAAPGCGEW
KKPMKSNPAYKGKWHAPLIENPSYKGIWKPQQIPNPAYFELEKPDFEPVAAIGIEIWTMQ
DGILFDNILITSDEKEAASYRETAWKPKFEVEKEKQKAEEEAAATPDVLSGIQKKVFDLL
YKIADIPFLEAYKLKIFVSFKHFFLCRLFLSVILGLILYSCGYVLFPRM
Download sequence
Identical sequences A0A2G5DAX4
Aquca_024_00012.8|PACid:22051366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]