SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5F4H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G5F4H3
Domain Number - Region: 73-137
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 0.0288
Family Adenylylcyclase toxin (the edema factor) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5F4H3
Sequence length 186
Comment (tr|A0A2G5F4H3|A0A2G5F4H3_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA62911.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00200727v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MARKMIGRKIFIKFGSILKSIMFLYTMIQQFVPYAIQSKFEKFVHELIGQYVHTLLGYWN
PNIQITFHEFVGEHMERSKAYTAIQSYLSKFSNQAKRLKADVGRNSTNVVLSMDDHEEVP
DEYEGVKLFRGDEKRYYKLTFYRWNREVVINSYLKHVLEKGNAIAVQNRQRWLYTNNTSY
NRLALH
Download sequence
Identical sequences A0A2G5F4H3
Aquca_002_00727.1|PACid:22053027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]