SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5N2G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5N2G3
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.66e-30
Family Frataxin-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5N2G3
Sequence length 110
Comment (tr|A0A2G5N2G3|A0A2G5N2G3_9PSED) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} OX=1712680 OS=Pseudomonas sp. 2995-3. GN=AOA62_26055 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSLTEARFHDLVDSTQQALEDIFDDSGLDVDLENSAGVLTVKFENGTQLIFSRQEPLRQL
WLAARSGGFHFDYNEEDKNWQCDTSDELLSEMLARLVQEQAGAELDFDEI
Download sequence
Identical sequences A0A2G5N2G3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]