SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G6U5P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G6U5P4
Domain Number - Region: 45-101
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00128
Family HBL-like 0.091
Further Details:      
 
Domain Number - Region: 83-143
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.017
Family E2F dimerization segment 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G6U5P4
Sequence length 215
Comment (tr|A0A2G6U5P4|A0A2G6U5P4_CALBS) Uncharacterized protein {ECO:0000313|EMBL:PIF41203.1} OX=31899 OS=Caldicellulosiruptor bescii (Anaerocellum thermophilum). GN=CLV06_0821 OC=Caldicellulosiruptor.
Sequence
MEKERKCRFKKGVNFLILVLVAGVLSLGVIFASTQSIDSNALVTYGFLKKQVDQLKAYID
NKINELDKKIKDTNTSSDQAQDISKLQSRVANLSSEIEKLKLQTAQLDAQLKNISSSSGV
KKGDFIYTKGYEVIKVPKNKTILFDASTEFVVRVGKAISVLPKGATIIDLTSAKDIGANQ
QLLFNHFYLVARSDGRGLKALDDVWVIVNGGYKIK
Download sequence
Identical sequences A0A2G6U5P4 B9MKY0
gi|222529879|ref|YP_002573761.1| 521460.Athe_1900 WP_015908282.1.1144 WP_015908282.1.22435 WP_015908282.1.28668 WP_015908282.1.33084 WP_015908282.1.45436 WP_015908282.1.58293 WP_015908282.1.61668 WP_015908282.1.71443 WP_015908282.1.77617 WP_015908282.1.9959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]