SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G6X0C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G6X0C1
Domain Number 1 Region: 1-194
Classification Level Classification E-value
Superfamily BB2672-like 1.57e-70
Family BB2672-like 0.000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G6X0C1
Sequence length 194
Comment (tr|A0A2G6X0C1|A0A2G6X0C1_9BURK) Amino acid synthesis protein {ECO:0000313|EMBL:PIF76095.1} OX=2035212 OS=Variovorax sp. 54. GN=CLU95_3255 OC=Comamonadaceae; Variovorax.
Sequence
MTANIRKLVIQVDETRKEMGQDVTPPTRRAVAIAVIENPYAGRYSENLDELIAIGEELGA
LLGQKAVKALGIEPGQVQSYGKAAIVGERGELEHAAAILHPKLGAPLRVAVEKGAALVPS
AKKQGTLGTAIDVPLGHKDAAFVRSHFDAIEARVADAPRANEIVVAVAVTDSGRPLPRIG
GLQASEIKGEDGLR
Download sequence
Identical sequences A0A2G6X0C1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]