SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G7JYY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G7JYY7
Domain Number - Region: 5-128
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000445
Family Capz alpha-1 subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G7JYY7
Sequence length 150
Comment (tr|A0A2G7JYY7|A0A2G7JYY7_STAEP) Uncharacterized protein {ECO:0000313|EMBL:PIH34182.1} OX=1282 OS=Staphylococcus epidermidis. GN=CTJ09_07620 OC=Staphylococcus.
Sequence
MRLNEINKVIKKVSEELTNINKKYNTDINIFFEDNGSYNHILFINNDDINNYVYFDLYYK
AAFMVDLYEYNNIDENDLIEQIKLNDENLTDEQINAYFNNSYTPQEYTFSIEIMRDHEID
TPYIEDHSIDLCYQSIIKEIKNFISDEVMK
Download sequence
Identical sequences A0A0N9SIV3 A0A2G7JYY7 Q5HMM3
WP_010959239.1.100433 WP_010959239.1.100800 WP_010959239.1.101292 WP_010959239.1.101732 WP_010959239.1.11097 WP_010959239.1.12195 WP_010959239.1.12254 WP_010959239.1.13713 WP_010959239.1.1487 WP_010959239.1.15050 WP_010959239.1.17245 WP_010959239.1.17536 WP_010959239.1.2143 WP_010959239.1.2266 WP_010959239.1.2357 WP_010959239.1.23919 WP_010959239.1.2398 WP_010959239.1.23999 WP_010959239.1.26887 WP_010959239.1.27020 WP_010959239.1.30044 WP_010959239.1.30590 WP_010959239.1.31449 WP_010959239.1.32007 WP_010959239.1.33089 WP_010959239.1.36410 WP_010959239.1.37572 WP_010959239.1.37755 WP_010959239.1.38090 WP_010959239.1.39200 WP_010959239.1.40535 WP_010959239.1.41570 WP_010959239.1.44120 WP_010959239.1.45766 WP_010959239.1.46159 WP_010959239.1.46800 WP_010959239.1.48683 WP_010959239.1.51168 WP_010959239.1.52629 WP_010959239.1.55309 WP_010959239.1.57912 WP_010959239.1.59612 WP_010959239.1.60263 WP_010959239.1.604 WP_010959239.1.60471 WP_010959239.1.61134 WP_010959239.1.63714 WP_010959239.1.64636 WP_010959239.1.64998 WP_010959239.1.65193 WP_010959239.1.65731 WP_010959239.1.67320 WP_010959239.1.67846 WP_010959239.1.69585 WP_010959239.1.72059 WP_010959239.1.72067 WP_010959239.1.75383 WP_010959239.1.76151 WP_010959239.1.79087 WP_010959239.1.80210 WP_010959239.1.80285 WP_010959239.1.80313 WP_010959239.1.81188 WP_010959239.1.81818 WP_010959239.1.82021 WP_010959239.1.8237 WP_010959239.1.82878 WP_010959239.1.84232 WP_010959239.1.85768 WP_010959239.1.89239 WP_010959239.1.89842 WP_010959239.1.910 WP_010959239.1.92296 WP_010959239.1.92977 WP_010959239.1.94358 WP_010959239.1.95367 WP_010959239.1.95589 YP_009226692.1.100275 176279.SERP1605 gi|57867525|ref|YP_189170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]