SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G7VTB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G7VTB1
Domain Number - Region: 52-110
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00667
Family Moesin tail domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G7VTB1
Sequence length 140
Comment (tr|A0A2G7VTB1|A0A2G7VTB1_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:PII67539.1} OX=1914912 OS=Serratia sp. OLHL2. GN=BMF90_01860 OC=Yersiniaceae; Serratia.
Sequence
MMRKHVNHALRMGMLCLLALSAAACQSQKPGKPAVNTQNQAAQPPSEEVLRKQREAEQLR
QCQEQLGALRTINEKQYQRYKQAFDSLMSGASQYANLRARVNGDTQETVDALYRYKVNYL
CAGVNQAVLTGLADRGEQVK
Download sequence
Identical sequences A0A0G8BDA3 A0A2G7UUE0 A0A2G7V854 A0A2G7VTB1 A0A2G7VTL8 A0A2G7WD66 A0A2G7WPK7 A0A2G7Y4H5 A0A2G8A144 A0A2G8BI99 A0A2G8C6T4 A0A2G8E1Y9 A0A2G8EQ05
WP_046686746.1.11966 WP_046686746.1.12767 WP_046686746.1.16816 WP_046686746.1.24705 WP_046686746.1.25419 WP_046686746.1.38859 WP_046686746.1.45018 WP_046686746.1.55230 WP_046686746.1.56175 WP_046686746.1.56280 WP_046686746.1.79481 WP_046686746.1.84378 WP_046686746.1.89943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]