SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G8KHF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8KHF3
Domain Number 1 Region: 7-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-100
Family Capz alpha-1 subunit 0.0000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G8KHF3
Sequence length 289
Comment (tr|A0A2G8KHF3|A0A2G8KHF3_STIJA) Putative F-actin-capping protein subunit alpha-1-like {ECO:0000313|EMBL:PIK47428.1} KW=Complete proteome OX=307972 OS=Stichopus japonicus (Sea cucumber). GN=BSL78_15721 OC=Apostichopus.
Sequence
MSGFEAISNDEKARIARDFIIHAPPGEFNEVFNDVRILVDNDNLLKEGASSAFVTYNKDQ
FTPVEVNGGDEKVLVTEFNDLGNGKFLDPSTKTTFKFDHLKKVATDSQSGSVDKTAEPWR
SELEKALKSYRSDHYKHGNVGAFAKSSGNSITLIACIEDHQFQPKNYWNGRWRSQWSVTF
DKSASSAEVKGILKVQVHYYEDGNVQLVSHKDIKEKLSIGSEAETAKALVKLMRDAEGEY
QAALSGDYLVMSDTTFKALRRVLPITRSKIDWNKITGYQIGQALKTETT
Download sequence
Identical sequences A0A2G8KHF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]