SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G8RN02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8RN02
Domain Number 1 Region: 4-288
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-75
Family Capz alpha-1 subunit 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G8RN02
Sequence length 301
Comment (tr|A0A2G8RN02|A0A2G8RN02_9APHY) Uncharacterized protein {ECO:0000313|EMBL:PIL22881.1} OX=1077348 OS=Ganoderma sinense ZZ0214-1. GN=GSI_15577 OC=Agaricomycetes; Polyporales; Polyporaceae; Ganoderma.
Sequence
MDPAERIEAASKFLLQSPPGEINDVLNDVRNIISDDDSLQAGVLPALREYNTTQFTTAEV
PGHQHQSIVSEAARVESSGDGEGEDEAASQDRYWDPRSRTSFRFDHLSLESSEPEPIEPD
SESEPFRVALETASLQYLQAHYHDGVTSVFPVAGSSTRFIIQIVANKYNPTNFWSGRWRS
EYTLDLAAQTLTGKILLSVHYYEQGNVQLSTTHAVSLALPPAIAVSGGAGAAAKALALVE
AEESRYQAGLADAYAEMGEKTFKGLRRALPMTRSKLDWDRVLGYKLGQELTNSKGVFGQP
A
Download sequence
Identical sequences A0A2G8RN02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]