SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H1GCX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H1GCX0
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.84e-71
Family Capz beta-1 subunit 0.000000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H1GCX0
Sequence length 276
Comment (tr|A0A2H1GCX0|A0A2H1GCX0_ZYMTR) Uncharacterized protein {ECO:0000313|EMBL:SMR51401.1} OX=1276532 OS=Zymoseptoria tritici ST99CH_1E4. GN=ZT1E4_G5620 OC=Zymoseptoria.
Sequence
MSDPFDAALDLLRRLPPSSTATNLAGIISLQPSLEEDLLSSVDVSLTARRCPKSGRDYLC
CDYNRDGASYRSPWSNEFDPKPEDPEEVGELIPSGRVRRMEEQLNMGVDVYRELYYEGGV
SSAYLWALDEGFAGVVLFKKETTAGKEGGWDSIHVLEVSEAATKRSAHYKLTSTVILDLG
LQSKEVDSLELAGNLTRQTQQDLPLNGLRDAEIEGCHVVNIGRMVEDMETRMRNLLQEVY
FGKARDVVGDLRSIQMLSEVGKDRAAHKEVIGKMNR
Download sequence
Identical sequences A0A1X7RTY3 A0A1Y6LKE7 A0A2H1GCX0 A0A2H1GGF6 F9X9U6
XP_003853192.1.87952 jgi|Mycgr1|68739|estExt_fgenesh2_pm.C_50261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]