SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H1GE18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H1GE18
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-82
Family Capz alpha-1 subunit 0.00000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H1GE18
Sequence length 274
Comment (tr|A0A2H1GE18|A0A2H1GE18_ZYMTR) Uncharacterized protein {ECO:0000313|EMBL:SMR51806.1} OX=1276537 OS=Zymoseptoria tritici ST99CH_3D1. GN=ZT3D1_G4973 OC=Zymoseptoria.
Sequence
MGSKEATIASFIEAAPPGELINVVNDIKTLASNQPNLLNSLEPAFKRYNEEQYTTVKLPG
SSEATIISQYNSLGDGRYFDTASQTSFAVDHATQQASDTQQHPLESQHADLIRSLLKSFS
TASAEHFPSSSIGVYPISSDSAIALALVANKYSPKNMWNGRWRSTYTFTPSSSTLSGTVK
ADVHYYEDGNVRMSTSKKLELSVGSSGGSAEGVVREIAKAENKFQEELNRAFGTLAEGSF
KSLRRQLPVTRQKIEWEKLGSYRVGQDIGGGRSK
Download sequence
Identical sequences A0A1X7RR20 A0A1Y6LGG8 A0A2H1GBD6 A0A2H1GE18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]