SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H1XFD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2H1XFD3
Domain Number - Region: 33-72
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0837
Family Capz beta-1 subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H1XFD3
Sequence length 391
Comment (tr|A0A2H1XFD3|A0A2H1XFD3_LEPIR) Uncharacterized protein {ECO:0000313|EMBL:SOR61922.1} KW=Complete proteome OX=214675 OS=Leptospira interrogans serovar Manilae. GN=LMANV2_360007 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MENFKDEILFELERLEGKTDENPLAILKKIKAYDYDGSLYRSVISKKYDPNWDDYKSFIN
ALYDKYLNKTFEILEKENDSFLREEIRKFALGFTIIKDNLYVILARLADDESFSILLEDS
KKVLETETDCPVIATPILCFLKLYGIEKYRERIRDFLLNSFEYARKYALKNRKYDYLGDN
LNSDIYLVISQGILSLNQEDREEFCDLMLNAYRFATERKRKYSMYQVSGYLAIYLTAFSR
RIESKVFDKSIATIGKNYLENKFVFQTRYAKWYLERNGSEALEFLRNCECYDQLGYIAAL
LADLDYKNAKHILQEKKKKVQDMIVIEIFLEAIVRLESQTSMPESQNRMIWMFESVSATQ
RALGASSDNVFLKRVQEKTEVDDRLQEADQE
Download sequence
Identical sequences A0A2H1XFD3 M5ZHJ5
WP_000427040.1.26235 WP_000427040.1.35515 WP_000427040.1.36297 WP_000427040.1.50403 WP_000427040.1.58842 WP_000427040.1.64963 WP_000427040.1.67052 WP_000427040.1.68135 WP_000427040.1.70921 WP_000427040.1.86894 WP_000427040.1.8916 WP_000427040.1.90631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]