SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3C0B9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3C0B9
Domain Number 1 Region: 4-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.09e-80
Family Capz alpha-1 subunit 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H3C0B9
Sequence length 288
Comment (tr|A0A2H3C0B9|A0A2H3C0B9_9AGAR) F-actin capping protein, alpha subunit {ECO:0000313|EMBL:PBK74714.1} KW=Complete proteome; Reference proteome OX=1076256 OS=Armillaria solidipes. GN=ARMSODRAFT_950743 OC=Armillaria.
Sequence
MDAKERIDAACSFLLQSPPGEINDVLNDVRNIISDDDSLQEGVLPALREYNLAQFMAVDV
PGTDHQSIVSEAARVDGTERFLDPRSQTSFAFDHLILEASDPQPVDPDEDSEPFRSALEK
ATLQYLSAHFHDGVSSVFSSTSSPNQFVIQVVANKYNPSNYWSGRWRSEYIVDLNEHKVD
GKVLVNVHYYEQGNVQLATTHTVSKTLPSAIVTSSPATSTTKILALIESEEGKFQSILND
TYQDMGEKTFKGLRRALPLTRQKMDWDKVLGYKLGAELSSSKGVFGSS
Download sequence
Identical sequences A0A2H3C0B9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]