SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3EBX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3EBX3
Domain Number 1 Region: 422-656
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-69
Family Capz alpha-1 subunit 0.0000137
Further Details:      
 
Domain Number 2 Region: 74-278
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-62
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000388
Further Details:      
 
Domain Number 3 Region: 263-390
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.03e-32
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3EBX3
Sequence length 665
Comment (tr|A0A2H3EBX3|A0A2H3EBX3_9HELO) Pyruvate dehydrogenase E1 component beta subunit {ECO:0000313|EMBL:PBP15660.1} KW=Complete proteome; Reference proteome OX=946125 OS=Diplocarpon rosae. GN=BUE80_DR013608 OC=Helotiales; Dermateaceae; Diplocarpon.
Sequence
MRVLHRAISRGVPPSRCRSSYSIFQTPINRWHSTLPAARLNIPTDFSTTSILEHTSQSAL
QNPEILTDTRNGTTKRMNLFQSINDALSLALAADESVILFGEDVAFGGVFRCSMGLAENF
GSERVFNTPLSEQGIVGFGIGAAAEGMKAIAEIQFADYVYPAFDQLVNEAAKFRYRDGKE
GRNSGGLTVRMPCGGVGHGALYHSQSPESLFTHIPGLRVIMPRSPIQAKGLLLSAIASKD
PCVFMEPKALYRAAVEQVPTGLYYLPLSKAEILKEGSDLTIVSYGHPLYTCSAAIEKAET
DLGISIELIDLRTVYPWDKECVFKSVRKTSRCVVVHESMINAGIGAEVAASIQEDTETFL
RLEAPVLRVAGWSVHMGLIFERFNIPDVAKPLSTTETTIQSERVSCDSRGIPTLANTCAM
SSPLATVSAFVEGAPPGELADVVADIKALTIDTPALVSQLGPAFEKYNEEQFATVKLPGS
SQHVGSKASAVQSYVLESSQSDLIKSLSKALSSHVKEHYSNASYGVFPIEDDSKIALLVV
ANKYSPNNFWNGRWRSLYILDPSSSSLSGSIKVDVHYYEDGNVRLLTTKPVSASVSSSSA
TTIVREITNAEKKYQEEVNKGFNNLSEGAFKGLRRQLPITRQKIEWDKIAGYRLGQDIGG
GSTKR
Download sequence
Identical sequences A0A2H3EBX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]