SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3G6W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3G6W1
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-86
Family Capz beta-1 subunit 0.0000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3G6W1
Sequence length 282
Comment (tr|A0A2H3G6W1|A0A2H3G6W1_GIBZA) F-actin capping protein subunit beta {ECO:0000313|EMBL:PCD22694.1} KW=Complete proteome OX=5518 OS=Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). GN=FGRA07_04064 OC=Fusarium.
Sequence
MAVDPFDSALDLLRRLNPKQTTDHLNAIISIAPDLTEDLLSSVDQPLTVRRCKQTGRDYL
LCDYNRDGDSYRSPWSNQFDPPLDEAGSGGVGAGGNEGAGEGAIPSERVRKMEVKANEAF
DVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSSPQGGNSEGVWDSIHVFEAIERGRSTH
YKLTSTVILTLSTSGGNLGEMDLSGNMTRQVEQDLPVENDDSHIANVGRLVEDMELKMRN
LLQEVYFGKAKDVVGDLRSIGSLSEGARDREAQRELIGSMRK
Download sequence
Identical sequences A0A1I9EY30 A0A2H3G6W1 K3W2P2 Q4INI2
5518.FG01226.1 FGSG_01226T0 XP_009253177.1.42154 XP_011317001.1.100342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]