SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3GTJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3GTJ3
Domain Number 1 Region: 373-390,418-489
Classification Level Classification E-value
Superfamily RING/U-box 4.16e-22
Family Zf-UBP 0.067
Further Details:      
 
Weak hits

Sequence:  A0A2H3GTJ3
Domain Number - Region: 522-615
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz alpha-1 subunit 0.011
Further Details:      
 
Domain Number - Region: 227-302
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0454
Family Canonical RBD 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3GTJ3
Sequence length 703
Comment (tr|A0A2H3GTJ3|A0A2H3GTJ3_GIBZA) Uncharacterized protein {ECO:0000313|EMBL:PCD33771.1} KW=Complete proteome OX=5518 OS=Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). GN=FGRA07_08926 OC=Fusarium.
Sequence
MPSYFYHIKFELYPTPDPLTASETEDRKDIWLPPPESSVFDDFPSHPRPDRQTTYRIPNT
PDSPSYNSENHTSPYTTVGQNSSTSSLGIIDCGTAARPPVKEAERKIEIVSERQWLERAN
SFPPPNSSAAIHPQNAVRDWRFGRVILETVDLRTGHTMAGEGSRNTPSAAPSLGPMFGGA
GTATKADLLPLETKNTELGWGVVHFYREGDETPSLVETEGQENGTGDSKSNDCTTLCIPA
VPAYMSPGDLMGFVGEKWRGDISHCRMIMTSRMNRYLVLLKFRDNVRAKQWRREFDGKVF
NTMEPQICHVVFVKNITFETPTRRKSSAALSPLSSSAGMSSSLRPFPPPTPNLVELPTCP
VCLERMDETNGLMTIPCSHVFHCTCLQNWKGAGCPVCRFTNTSPDANSDPSNPHTQPFGS
GASNLCTICGCTDDLWICLICGYVGCGRYKGGHAKDHWKETAHCFSLELETQHVWDYAGD
MWVHRLIRAKGDGKVVELPSRNRSIGHLEEEDVVPRAKLESIGLEYTHLVTSQLESQRAY
YEELISKTVDKASKASATAESAIVQASKAMEKLALLDEKYTTLSEETIPELERQLERERN
KSNKSETLARNLGKSLQEEKRLNEGLMKRIEHLNNDHEAMAMKLEKVKAENADLQEMNRD
LSMFISGQEKLKELENEGKIAEGELEGGSASVPEKKSRRRAKR
Download sequence
Identical sequences A0A2H3GTJ3 I1RWT5
5518.FG08767.1 XP_011319956.1.100342 FGSG_08767T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]