SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3HM18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3HM18
Domain Number 1 Region: 28-84
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000327
Family Transducin (heterotrimeric G protein), gamma chain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3HM18
Sequence length 93
Comment (tr|A0A2H3HM18|A0A2H3HM18_GIBZA) Guanine nucleotide-binding protein subunit gamma {ECO:0000313|EMBL:PCD40644.1} KW=Complete proteome OX=5518 OS=Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). GN=FGRA07_01915 OC=Fusarium.
Sequence
MPQYTSRDVGDPSQIKKNKQSMADLKLRRLTELNNRLREDLERERIPVSTASKSIIAYCN
GTRDYMVPSVWGAVPKGEDPYAPQQSGGCCVVM
Download sequence
Identical sequences A0A0D2XE50 A0A0I9ZEH1 A0A0M9F3I7 A0A1L7T091 A0A1L7VKB2 A0A2H3HM18 A0A2H3TMY5 A0A2K0W807 B8XWZ9 F9FBB4 I1RSV0 K3VV89 N1RI03 N4U678 S0DUS6 W7LZW5 W9IZF8 W9KI48 W9Q2D8 X0ALJ2 X0DCD6 X0IN65 X0K5Z2 X0NVM0
XP_009251594.1.42154 XP_011326970.1.100342 XP_018235565.1.49799 XP_018750397.1.41959 XP_018750398.1.41959 XP_018750399.1.41959 5518.FG07235.1 FOXG_02181T0 FGSG_07235T0 FVEG_05349T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]