SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3HSU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3HSU8
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.02e-86
Family Capz beta-1 subunit 0.0000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3HSU8
Sequence length 282
Comment (tr|A0A2H3HSU8|A0A2H3HSU8_FUSOX) Uncharacterized protein {ECO:0000313|EMBL:PCD45271.1} KW=Complete proteome; Reference proteome OX=327505 OS=Fusarium oxysporum f. sp. radicis-cucumerinum. GN=AU210_000711 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MAVDPFDSALDLLRRLNPKQTTDHLNAIISIAPDLTEDLLSSVDQPLTVRRCKQTGRDYL
LCDYNRDGDSYRSPWSNQFDPPLDEAGSGGVGAGGNEGAGEGAIPSERVRKMEVKANEAF
DVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSSPQGGNSEGVWDSIHVFEAIERGRSTH
YKLTSTVILTLSTTGGNLGEMDLSGNMTRQVEQDLPVDNDDSHIANVGRLVEDMELKMRN
LLQEVYFGKAKDVVGDLRSIGSLSEGARDREAQRELIGSMRR
Download sequence
Identical sequences A0A0D2X8F3 A0A2H3HSU8 A0A2H3T2U4 F9FZ21 N4TVQ2 W9IIT5 W9L0C8 W9Q7U8 X0BR55 X0CDP2 X0JFR4 X0M4T3
FOXG_00162T0 XP_018231848.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]