SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3I5X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3I5X2
Domain Number 1 Region: 152-243
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.57e-32
Family VPS28 C-terminal domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 26-122
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.93e-32
Family VPS28 N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3I5X2
Sequence length 244
Comment (tr|A0A2H3I5X2|A0A2H3I5X2_9EURO) ESCRT-I complex subunit VPS28 {ECO:0000256|PIRNR:PIRNR017535} KW=Complete proteome; Reference proteome OX=290292 OS=Penicillium occitanis. GN=PENO1_082220 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MHSQRPLSYAPTPYSYTPNPALSATISLDEEVKLASSSAERDLYESLAEIYSIIVTLDGL
EKAYIRDAIPESEYTETCARLLKQYKSTLGDETVAREFVDLETFKRTWQLECPRATERLR
IGLPATVEQASHGAHTPSGGMPTNAPTGGASGSLILTATENFITFLDALKLNMVSKDALH
PLLSEVIQSVNKVTDRDFESRGKIIQWLITLNQMRATEELSDDQARELSFDIEQAYQGFK
ATLN
Download sequence
Identical sequences A0A2H3I5X2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]