SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3IAF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3IAF2
Domain Number 1 Region: 3-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.23e-87
Family Capz beta-1 subunit 0.0000000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H3IAF2
Sequence length 267
Comment (tr|A0A2H3IAF2|A0A2H3IAF2_9EURO) WASH complex, F-actin capping protein, beta subunit {ECO:0000313|EMBL:PCG92959.1} KW=Complete proteome; Reference proteome OX=290292 OS=Penicillium occitanis. GN=PENO1_086000 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MADTQFDSALDLLRRLSPRDTGKNLQSITNLVPDLTEDLLASVDQPLEVRRCLKSNRDYL
LCDYNRDGDSYRSPWSNEFDPPIEDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVVLLKKGVTPGGKSSGAWDSIHVFEATDRARMTHYKLTSTVILHLSNESD
ALGEMNLSGNMTRQVEADLPFESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGD
LRSIAPLSETNQERAAHREMINSMSKR
Download sequence
Identical sequences A0A2H3IAF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]